| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) ![]() |
| Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
| Protein automated matches [191196] (7 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [226818] (1 PDB entry) |
| Domain d2vvre_: 2vvr E: [206498] automated match to d3k7sa_ mutant |
PDB Entry: 2vvr (more details), 2.1 Å
SCOPe Domain Sequences for d2vvre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vvre_ c.121.1.0 (E:) automated matches {Escherichia coli [TaxId: 83333]}
mkkiafgcdhvgfilkheivahlvergvevidkgtwssertdyphyasqvalavaggevd
ggilicgtgvgisiaankfagiravvcsepysaqlsrqnndtnvlafgsrvvglelakmi
vdawlgaqyeggrhqqrveaitaieqr
Timeline for d2vvre_: