SCOPe 2.03: Domain d2vvrd_: 2vvr D:

Lineage for d2vvrd_ (2vvr D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [226818] (1 PDB entry)

8. Domain d2vvrd_: 2vvr D: [206497]
   automated match to d3k7sa_
   mutant

Details for d2vvrd_

PDB Entry: 2vvr, 2.1 Å

PDB Description: crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate

PDB Compounds: (D:) ribose-5-phosphate isomerase b

SCOPe Domain Sequences for d2vvrd_:

Sequence; same for both SEQRES and ATOM records:

>d2vvrd_ c.121.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
mkkiafgcdhvgfilkheivahlvergvevidkgtwssertdyphyasqvalavaggevd
ggilicgtgvgisiaankfagiravvcsepysaqlsrqnndtnvlafgsrvvglelakmi
vdawlgaqyeggrhqqrveaitaieq

Timeline for d2vvrd_:

• d2vvrd_ is new in SCOPe 2.03-stable
  
• d2vvrd_ appears in SCOPe 2.04
  
• d2vvrd_ appears in the current release, SCOPe 2.08