Lineage for d2vvra_ (2vvr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2922038Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2922039Protein automated matches [191196] (11 species)
    not a true protein
  7. 2922051Species Escherichia coli K-12 [TaxId:83333] [226818] (1 PDB entry)
  8. 2922052Domain d2vvra_: 2vvr A: [206494]
    automated match to d3k7sa_
    mutant

Details for d2vvra_

PDB Entry: 2vvr (more details), 2.1 Å

PDB Description: crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate
PDB Compounds: (A:) ribose-5-phosphate isomerase b

SCOPe Domain Sequences for d2vvra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvra_ c.121.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mkkiafgcdhvgfilkheivahlvergvevidkgtwssertdyphyasqvalavaggevd
ggilicgtgvgisiaankfagiravvcsepysaqlsrqnndtnvlafgsrvvglelakmi
vdawlgaqyeggrhqqrveaitaieqr

SCOPe Domain Coordinates for d2vvra_:

Click to download the PDB-style file with coordinates for d2vvra_.
(The format of our PDB-style files is described here.)

Timeline for d2vvra_: