Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (11 PDB entries) |
Domain d1qsfe1: 1qsf E:3-118 [20649] Other proteins in same PDB: d1qsfa1, d1qsfa2, d1qsfb_, d1qsfd2, d1qsfe2 |
PDB Entry: 1qsf (more details), 2.8 Å
SCOP Domain Sequences for d1qsfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsfe1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain} gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted
Timeline for d1qsfe1: