SCOPe 2.05: Domain d2vura1: 2vur A:41-178

Lineage for d2vura1 (2vur A:41-178)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)

6. Protein Hyaluronidase N-terminal domain [143619] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries)
   Uniprot Q8XL08 41-178

8. Domain d2vura1: 2vur A:41-178 [206488]
   Other proteins in same PDB: d2vura2, d2vura3, d2vurb2, d2vurb3
   automated match to d2cbia3
   complexed with so4, yx1

Details for d2vura1

PDB Entry: 2vur, 2.2 Å

PDB Description: chemical dissection of the link between streptozotocin, o-glcnac and pancreatic cell death

PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2vura1:

Sequence; same for both SEQRES and ATOM records:

>d2vura1 d.92.2.3 (A:41-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn
sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk
qlvkesnipevnitdypt

Timeline for d2vura1:

• d2vura1 first appeared in SCOPe 2.03
  
• d2vura1 appears in SCOPe 2.04
  
• d2vura1 appears in SCOPe 2.06
  
• d2vura1 appears in the current release, SCOPe 2.08