Lineage for d2vupa_ (2vup A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880496Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225474] (6 PDB entries)
  8. 2880499Domain d2vupa_: 2vup A: [206487]
    automated match to d3cync_

Details for d2vupa_

PDB Entry: 2vup (more details), 2.1 Å

PDB Description: crystal structure of a type ii tryparedoxin-dependant peroxidase from trypanosoma brucei
PDB Compounds: (A:) glutathione peroxidase-like protein

SCOPe Domain Sequences for d2vupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vupa_ c.47.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
aassifdfevldadhkpynlvqhkgsplliynvaskcgytkggyetattlynkyksqgft
vlafpcnqfggqepgneeeikefvctkfkaefpimakinvngenahplyeymkktkpgil
ktkaikwnftsflidrdgvpverfspgasvkdiekklipllest

SCOPe Domain Coordinates for d2vupa_:

Click to download the PDB-style file with coordinates for d2vupa_.
(The format of our PDB-style files is described here.)

Timeline for d2vupa_: