SCOPe 2.08: Domain d2vuob2: 2vuo B:342-444

Lineage for d2vuob2 (2vuo B:342-444)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d2vuob2: 2vuo B:342-444 [206486]
   automated match to d1igyb4
   complexed with azi, fmt, gol

Details for d2vuob2

PDB Entry: 2vuo, 1.95 Å

PDB Description: crystal structure of the rabbit igg fc fragment

PDB Compounds: (B:) ig gamma chain c region

SCOPe Domain Sequences for d2vuob2:

Sequence; same for both SEQRES and ATOM records:

>d2vuob2 b.1.1.0 (B:342-444) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qplepkvytmgppreelssrsvsltcmingfypsdisvewekngkaednykttpavldsd
gsyflysklsvptsewqrgdvftcsvmhealhnhytqksisrs

Timeline for d2vuob2:

• d2vuob2 first appeared in SCOPe 2.03
  
• d2vuob2 appears in SCOPe 2.07