Lineage for d2vuob2 (2vuo B:342-444)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)
  8. 2761435Domain d2vuob2: 2vuo B:342-444 [206486]
    automated match to d1igyb4
    complexed with azi, fmt, gol

Details for d2vuob2

PDB Entry: 2vuo (more details), 1.95 Å

PDB Description: crystal structure of the rabbit igg fc fragment
PDB Compounds: (B:) ig gamma chain c region

SCOPe Domain Sequences for d2vuob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vuob2 b.1.1.0 (B:342-444) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qplepkvytmgppreelssrsvsltcmingfypsdisvewekngkaednykttpavldsd
gsyflysklsvptsewqrgdvftcsvmhealhnhytqksisrs

SCOPe Domain Coordinates for d2vuob2:

Click to download the PDB-style file with coordinates for d2vuob2.
(The format of our PDB-style files is described here.)

Timeline for d2vuob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vuob1