Lineage for d2vukb_ (2vuk B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2767926Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2768088Protein automated matches [190198] (2 species)
    not a true protein
  7. 2768089Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2768130Domain d2vukb_: 2vuk B: [206482]
    automated match to d2ahia_
    complexed with p83, zn; mutant

Details for d2vukb_

PDB Entry: 2vuk (more details), 1.5 Å

PDB Description: structure of the p53 core domain mutant y220c bound to the stabilizing small-molecule drug phikan083
PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2vukb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vukb_ b.2.5.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrh
svvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrv
cacpgrdrrteeenlr

SCOPe Domain Coordinates for d2vukb_:

Click to download the PDB-style file with coordinates for d2vukb_.
(The format of our PDB-style files is described here.)

Timeline for d2vukb_: