Lineage for d2vuja_ (2vuj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780285Species Escherichia coli [TaxId:562] [225391] (2 PDB entries)
  8. 2780287Domain d2vuja_: 2vuj A: [206480]
    automated match to d1m4wa_
    complexed with gol

Details for d2vuja_

PDB Entry: 2vuj (more details), 1.8 Å

PDB Description: environmentally isolated gh11 xylanase
PDB Compounds: (A:) gh11 xylanase

SCOPe Domain Sequences for d2vuja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vuja_ b.29.1.11 (A:) automated matches {Escherichia coli [TaxId: 562]}
qtcltssqtgtnngfyysfwkdspgtvnfclqsggrytsnwsginnwvggkgwqtgsrrn
itysgsfnspgngylalygwttnplveyyvvdswgswrppgsdgtflgtvnsdggtydiy
raqrvnapsiignatfyqywsvrqskrvggtittgnhfdawasvglnlgthnyqimateg
yqssgssditvseggg

SCOPe Domain Coordinates for d2vuja_:

Click to download the PDB-style file with coordinates for d2vuja_.
(The format of our PDB-style files is described here.)

Timeline for d2vuja_: