Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein automated matches [190135] (18 species) not a true protein |
Species Escherichia coli [TaxId:562] [225391] (2 PDB entries) |
Domain d2vuja_: 2vuj A: [206480] automated match to d1m4wa_ complexed with gol |
PDB Entry: 2vuj (more details), 1.8 Å
SCOPe Domain Sequences for d2vuja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vuja_ b.29.1.11 (A:) automated matches {Escherichia coli [TaxId: 562]} qtcltssqtgtnngfyysfwkdspgtvnfclqsggrytsnwsginnwvggkgwqtgsrrn itysgsfnspgngylalygwttnplveyyvvdswgswrppgsdgtflgtvnsdggtydiy raqrvnapsiignatfyqywsvrqskrvggtittgnhfdawasvglnlgthnyqimateg yqssgssditvseggg
Timeline for d2vuja_: