Lineage for d1qsee1 (1qse E:3-118)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 220318Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 220329Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (10 PDB entries)
  8. 220336Domain d1qsee1: 1qse E:3-118 [20648]
    Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb_, d1qsed2, d1qsee2

Details for d1qsee1

PDB Entry: 1qse (more details), 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r

SCOP Domain Sequences for d1qsee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsee1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted

SCOP Domain Coordinates for d1qsee1:

Click to download the PDB-style file with coordinates for d1qsee1.
(The format of our PDB-style files is described here.)

Timeline for d1qsee1: