Lineage for d1qsee1 (1qse E:3-118)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 103212Protein T-cell antigen receptor [48933] (6 species)
  7. 103220Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (6 PDB entries)
  8. 103224Domain d1qsee1: 1qse E:3-118 [20648]
    Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb1, d1qsed2, d1qsee2

Details for d1qsee1

PDB Entry: 1qse (more details), 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r

SCOP Domain Sequences for d1qsee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsee1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted

SCOP Domain Coordinates for d1qsee1:

Click to download the PDB-style file with coordinates for d1qsee1.
(The format of our PDB-style files is described here.)

Timeline for d1qsee1: