SCOP 1.59: Domain d1qsee1: 1qse E:3-118

Lineage for d1qsee1 (1qse E:3-118)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (6 PDB entries)

8. Domain d1qsee1: 1qse E:3-118 [20648]
   Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb1, d1qsed2, d1qsee2

Details for d1qsee1

PDB Entry: 1qse, 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r

SCOP Domain Sequences for d1qsee1:

Sequence; same for both SEQRES and ATOM records:

>d1qsee1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted

Timeline for d1qsee1:

• d1qsee1 first appeared (with stable ids) in SCOP 1.55
  
• d1qsee1 appears in SCOP 1.57
  
• d1qsee1 appears in SCOP 1.61
  
• d1qsee1 appears in the current release, SCOPe 2.08