Lineage for d2vuhb_ (2vuh B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838256Species Rhodobacter capsulatus [TaxId:1061] [225556] (3 PDB entries)
  8. 1838258Domain d2vuhb_: 2vuh B: [206478]
    automated match to d1xhea1
    mutant

Details for d2vuhb_

PDB Entry: 2vuh (more details), 2.5 Å

PDB Description: crystal structure of the d55e mutant of the hupr receiver domain
PDB Compounds: (B:) hydrogenase transcriptional regulatory protein hupr1

SCOPe Domain Sequences for d2vuhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vuhb_ c.23.1.0 (B:) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
apaillvddephslaamklaleddfdvltaqgaeaaiaileeewvqviiceqrmpgrtgv
dfltevrerwpetvriiitgytdsasmmaaindagihqfltkpwhpeqllssarnaarmf
tlarenerlslemrl

SCOPe Domain Coordinates for d2vuhb_:

Click to download the PDB-style file with coordinates for d2vuhb_.
(The format of our PDB-style files is described here.)

Timeline for d2vuhb_: