SCOPe 2.08: Domain d2vu0d1: 2vu0 D:3-268

Lineage for d2vu0d1 (2vu0 D:3-268)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries)
   Uniprot P07097

8. Domain d2vu0d1: 2vu0 D:3-268 [206460]
   Other proteins in same PDB: d2vu0a2, d2vu0b2, d2vu0c2, d2vu0d2
   automated match to d1m4ta1
   complexed with coa, gol, so4
   has additional insertions and/or extensions that are not grouped together

Details for d2vu0d1

PDB Entry: 2vu0, 1.87 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the oxidised enzyme with coenzyme a.

PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2vu0d1:

Sequence; same for both SEQRES and ATOM records:

>d2vu0d1 c.95.1.1 (D:3-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]}
psiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpage
gqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsma
phcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavas
qnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvt
agnasglndgaaaallmseaeasrrg

Timeline for d2vu0d1:

• d2vu0d1 first appeared in SCOPe 2.03
  
• d2vu0d1 appears in SCOPe 2.07