Lineage for d1ao7e1 (1ao7 E:3-118)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries) 
Domain d1ao7e1: 1ao7 E:3-118 [20646]
Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b2, d1ao7b3, d1ao7e2
complexed with emc
Details for d1ao7e1
PDB Entry: 1ao7 (more details), 2.6 Å
PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201
PDB Compounds: (E:) t cell receptor betaSCOPe Domain Sequences for d1ao7e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ao7e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted
SCOPe Domain Coordinates for d1ao7e1:
Click to download the PDB-style file with coordinates for d1ao7e1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ao7e1:
View in 3D
