![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (32 PDB entries) |
![]() | Domain d1ao7e1: 1ao7 E:3-118 [20646] Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b_, d1ao7e2 complexed with emc |
PDB Entry: 1ao7 (more details), 2.6 Å
SCOPe Domain Sequences for d1ao7e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ao7e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted
Timeline for d1ao7e1:
![]() Domains from other chains: (mouse over for more information) d1ao7a1, d1ao7a2, d1ao7b_, d1ao7d_ |