SCOP 1.61: Domain d1ao7e1: 1ao7 E:3-118

Lineage for d1ao7e1 (1ao7 E:3-118)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (8 PDB entries)

8. Domain d1ao7e1: 1ao7 E:3-118 [20646]
   Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b1, d1ao7e2

Details for d1ao7e1

PDB Entry: 1ao7, 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201

SCOP Domain Sequences for d1ao7e1:

Sequence; same for both SEQRES and ATOM records:

>d1ao7e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted

Timeline for d1ao7e1:

• d1ao7e1 first appeared (with stable ids) in SCOP 1.55
  
• d1ao7e1 appears in SCOP 1.59
  
• d1ao7e1 appears in SCOP 1.63
  
• d1ao7e1 appears in the current release, SCOPe 2.08