Lineage for d1ao7e1 (1ao7 E:3-118)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 52846Protein T-cell antigen receptor [48933] (6 species)
  7. 52854Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (6 PDB entries)
  8. 52860Domain d1ao7e1: 1ao7 E:3-118 [20646]
    Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b1, d1ao7e2

Details for d1ao7e1

PDB Entry: 1ao7 (more details), 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201

SCOP Domain Sequences for d1ao7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao7e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted

SCOP Domain Coordinates for d1ao7e1:

Click to download the PDB-style file with coordinates for d1ao7e1.
(The format of our PDB-style files is described here.)

Timeline for d1ao7e1: