SCOPe 2.07: Domain d2vsxb2: 2vsx B:227-393

Lineage for d2vsxb2 (2vsx B:227-393)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (13 PDB entries)

8. Domain d2vsxb2: 2vsx B:227-393 [206445]
   automated match to d1xtia2
   protein/RNA complex; complexed with amp

Details for d2vsxb2

PDB Entry: 2vsx, 2.8 Å

PDB Description: crystal structure of a translation initiation complex

PDB Compounds: (B:) ATP-dependent RNA helicase eif4a

SCOPe Domain Sequences for d2vsxb2:

Sequence, based on SEQRES records:

>d2vsxb2 c.37.1.0 (B:227-393) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
deltlegikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkft
vsaiysdlpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyih
rigrggrfgrkgvainfvtnedvgamrelekfystqieelpsdiatl

Sequence, based on observed residues (ATOM records):

>d2vsxb2 c.37.1.0 (B:227-393) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
deltlegikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkft
vsaiysdlpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyih
rigrkgvainfvtnedvgamrelekfystqieelpsdiatl

Timeline for d2vsxb2:

• d2vsxb2 first appeared in SCOPe 2.03
  
• d2vsxb2 appears in SCOPe 2.06
  
• d2vsxb2 appears in the current release, SCOPe 2.08