SCOPe 2.05: Domain d2vsuf_: 2vsu F:

Lineage for d2vsuf_ (2vsu F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries)

8. Domain d2vsuf_: 2vsu F: [206440]
   automated match to d3peaf_
   complexed with aco, v55

Details for d2vsuf_

PDB Entry: 2vsu, 1.9 Å

PDB Description: a ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism.

PDB Compounds: (F:) p-hydroxycinnamoyl coa hydratase/lyase

SCOPe Domain Sequences for d2vsuf_:

Sequence; same for both SEQRES and ATOM records:

>d2vsuf_ c.14.1.0 (F:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
yegrwktvkveiedgiafvilnrperrnamsptlnremidvletleqdpaagvlvltgag
eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfa
plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakld
qsrlld

Timeline for d2vsuf_:

• d2vsuf_ first appeared in SCOPe 2.03
  
• d2vsuf_ appears in SCOPe 2.04
  
• d2vsuf_ appears in SCOPe 2.06
  
• d2vsuf_ appears in the current release, SCOPe 2.08