Lineage for d2vsue_ (2vsu E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100504Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries)
  8. 2100521Domain d2vsue_: 2vsu E: [206439]
    automated match to d3peaf_
    complexed with aco, v55

Details for d2vsue_

PDB Entry: 2vsu (more details), 1.9 Å

PDB Description: a ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism.
PDB Compounds: (E:) p-hydroxycinnamoyl coa hydratase/lyase

SCOPe Domain Sequences for d2vsue_:

Sequence, based on SEQRES records: (download)

>d2vsue_ c.14.1.0 (E:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
tyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltga
geawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggf
aplvacdlaicadeatfglseinygippgnlvskamadtvghrqslyyimtgktfggqka
aemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakl
dqsrlld

Sequence, based on observed residues (ATOM records): (download)

>d2vsue_ c.14.1.0 (E:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
tyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltga
geawtagmdlkeyfrevgpeilqekirreasqwqwkllrmyakptiamvngwcfgggfap
lvacdlaicadeatfglseinygippgnlvskamadtvghrqslyyimtgktfggqkaae
mglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakldq
srlld

SCOPe Domain Coordinates for d2vsue_:

Click to download the PDB-style file with coordinates for d2vsue_.
(The format of our PDB-style files is described here.)

Timeline for d2vsue_: