SCOPe 2.03: Domain d2vssb_: 2vss B:

Lineage for d2vssb_ (2vss B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (42 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries)

8. Domain d2vssb_: 2vss B: [206430]
   automated match to d3peaf_
   complexed with aco, v55

Details for d2vssb_

PDB Entry: 2vss, 2.22 Å

PDB Description: wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin

PDB Compounds: (B:) p-hydroxycinnamoyl coa hydratase/lyase

SCOPe Domain Sequences for d2vssb_:

Sequence; same for both SEQRES and ATOM records:

>d2vssb_ c.14.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfs
plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakld
qsrlldte

Timeline for d2vssb_:

• d2vssb_ is new in SCOPe 2.03-stable
  
• d2vssb_ appears in SCOPe 2.04
  
• d2vssb_ appears in the current release, SCOPe 2.08