Lineage for d2vssa_ (2vss A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100504Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries)
  8. 2100523Domain d2vssa_: 2vss A: [206429]
    automated match to d3peaf_
    complexed with aco, v55

Details for d2vssa_

PDB Entry: 2vss (more details), 2.22 Å

PDB Description: wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl-coa and vanillin
PDB Compounds: (A:) p-hydroxycinnamoyl coa hydratase/lyase

SCOPe Domain Sequences for d2vssa_:

Sequence, based on SEQRES records: (download)

>d2vssa_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfs
plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakld
qsrlldt

Sequence, based on observed residues (ATOM records): (download)

>d2vssa_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
eawtagmdlagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfsplvacdla
icadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaaemglvnes
vplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakldqsrlldt

SCOPe Domain Coordinates for d2vssa_:

Click to download the PDB-style file with coordinates for d2vssa_.
(The format of our PDB-style files is described here.)

Timeline for d2vssa_: