Lineage for d2vsoa2 (2vso A:227-393)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2113975Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (12 PDB entries)
  8. 2113984Domain d2vsoa2: 2vso A:227-393 [206426]
    automated match to d1xtia2
    protein/RNA complex; complexed with amp

Details for d2vsoa2

PDB Entry: 2vso (more details), 2.6 Å

PDB Description: crystal structure of a translation initiation complex
PDB Compounds: (A:) ATP-dependent RNA helicase eif4a

SCOPe Domain Sequences for d2vsoa2:

Sequence, based on SEQRES records: (download)

>d2vsoa2 c.37.1.0 (A:227-393) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
deltlegikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkft
vsaiysdlpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyih
rigrggrfgrkgvainfvtnedvgamrelekfystqieelpsdiatl

Sequence, based on observed residues (ATOM records): (download)

>d2vsoa2 c.37.1.0 (A:227-393) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
deltlegikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkft
vsaiysdlpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyih
rigrkgvainfvtnedvgamrelekfystqieelpsdiatl

SCOPe Domain Coordinates for d2vsoa2:

Click to download the PDB-style file with coordinates for d2vsoa2.
(The format of our PDB-style files is described here.)

Timeline for d2vsoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vsoa1