SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2vsoa1 (2vso A:12-226)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (119 species)
    not a true protein
  7. 2113975Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (12 PDB entries)
  8. 2113983Domain d2vsoa1: 2vso A:12-226 [206425]
    automated match to d1xtia1
    protein/RNA complex; complexed with amp

Details for d2vsoa1

PDB Entry: 2vso (more details), 2.6 Å

PDB Description: crystal structure of a translation initiation complex
PDB Compounds: (A:) ATP-dependent RNA helicase eif4a

SCOPe Domain Sequences for d2vsoa1:

Sequence, based on SEQRES records: (download)

>d2vsoa1 c.37.1.0 (A:12-226) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
ppttqvvllsatmpndvlevttkfmrnpvrilvkk

Sequence, based on observed residues (ATOM records): (download)

>d2vsoa1 c.37.1.0 (A:12-226) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciglrdaq
ivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllppttqvvlls
atmpndvlevttkfmrnpvrilvkk

SCOPe Domain Coordinates for d2vsoa1:

Click to download the PDB-style file with coordinates for d2vsoa1.
(The format of our PDB-style files is described here.)

Timeline for d2vsoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vsoa2