![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (71 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries) |
![]() | Domain d2vreb1: 2vre B:24-282 [206423] Other proteins in same PDB: d2vrea2, d2vreb2, d2vrec2 automated match to d3g64c_ complexed with cl |
PDB Entry: 2vre (more details), 1.95 Å
SCOPe Domain Sequences for d2vreb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vreb1 c.14.1.0 (B:24-282) automated matches {Human (Homo sapiens) [TaxId: 9606]} apdhsyeslrvtsaqkhvlhvqlnrpnkrnamnkvfwremvecfnkisrdadcravvisg agkmftagidlmdmasdilqpkgddvariswylrdiitryqetfnviercpkpviaavhg gcigggvdlvtacdirycaqdaffqvkevdvglaadvgtlqrlpkvignqslvnelafta rkmmadealgsglvsrvfpdkevmldaalalaaeisskspvavqstkvnllysrdhsvae slnyvaswnmsmlqtqdlv
Timeline for d2vreb1:
![]() Domains from other chains: (mouse over for more information) d2vrea1, d2vrea2, d2vrec1, d2vrec2 |