SCOPe 2.06: Domain d2vrea1: 2vre A:24-289

Lineage for d2vrea1 (2vre A:24-289)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)

8. Domain d2vrea1: 2vre A:24-289 [206422]
   Other proteins in same PDB: d2vrea2, d2vreb2, d2vrec2
   automated match to d3g64c_
   complexed with cl

Details for d2vrea1

PDB Entry: 2vre, 1.95 Å

PDB Description: crystal structure of human peroxisomal delta3,5,delta2,4-dienoyl coa isomerase

PDB Compounds: (A:) delta(3,5)-delta(2,4)-dienoyl-coa isomerase

SCOPe Domain Sequences for d2vrea1:

Sequence; same for both SEQRES and ATOM records:

>d2vrea1 c.14.1.0 (A:24-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apdhsyeslrvtsaqkhvlhvqlnrpnkrnamnkvfwremvecfnkisrdadcravvisg
agkmftagidlmdmasdilqpkgddvariswylrdiitryqetfnviercpkpviaavhg
gcigggvdlvtacdirycaqdaffqvkevdvglaadvgtlqrlpkvignqslvnelafta
rkmmadealgsglvsrvfpdkevmldaalalaaeisskspvavqstkvnllysrdhsvae
slnyvaswnmsmlqtqdlvksvqatt

Timeline for d2vrea1:

• d2vrea1 first appeared in SCOPe 2.03, called d2vrea_
  
• d2vrea1 was called d2vrea_ in SCOPe 2.05
  
• d2vrea1 appears in SCOPe 2.07
  
• d2vrea1 appears in the current release, SCOPe 2.08