Lineage for d2vrea1 (2vre A:24-289)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853751Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)
  8. 2853763Domain d2vrea1: 2vre A:24-289 [206422]
    Other proteins in same PDB: d2vrea2, d2vreb2, d2vrec2
    automated match to d3g64c_
    complexed with cl

Details for d2vrea1

PDB Entry: 2vre (more details), 1.95 Å

PDB Description: crystal structure of human peroxisomal delta3,5,delta2,4-dienoyl coa isomerase
PDB Compounds: (A:) delta(3,5)-delta(2,4)-dienoyl-coa isomerase

SCOPe Domain Sequences for d2vrea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrea1 c.14.1.0 (A:24-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apdhsyeslrvtsaqkhvlhvqlnrpnkrnamnkvfwremvecfnkisrdadcravvisg
agkmftagidlmdmasdilqpkgddvariswylrdiitryqetfnviercpkpviaavhg
gcigggvdlvtacdirycaqdaffqvkevdvglaadvgtlqrlpkvignqslvnelafta
rkmmadealgsglvsrvfpdkevmldaalalaaeisskspvavqstkvnllysrdhsvae
slnyvaswnmsmlqtqdlvksvqatt

SCOPe Domain Coordinates for d2vrea1:

Click to download the PDB-style file with coordinates for d2vrea1.
(The format of our PDB-style files is described here.)

Timeline for d2vrea1: