Lineage for d1d9kf_ (1d9k F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023718Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2023862Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
  8. 2023904Domain d1d9kf_: 1d9k F: [20642]
    Other proteins in same PDB: d1d9kc1, d1d9kc2, d1d9kd1, d1d9kd2, d1d9kg1, d1d9kg2, d1d9kh1, d1d9kh2
    complexed with ndg

Details for d1d9kf_

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca
PDB Compounds: (F:) T-cell receptor d10 (beta chain)

SCOPe Domain Sequences for d1d9kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9kf_ b.1.1.1 (F:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgs

SCOPe Domain Coordinates for d1d9kf_:

Click to download the PDB-style file with coordinates for d1d9kf_.
(The format of our PDB-style files is described here.)

Timeline for d1d9kf_: