Lineage for d2vq1e2 (2vq1 E:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752660Domain d2vq1e2: 2vq1 E:108-212 [206416]
    Other proteins in same PDB: d2vq1a1, d2vq1b_, d2vq1e1, d2vq1f_
    automated match to d1t66c2
    complexed with azi, gly, gol

Details for d2vq1e2

PDB Entry: 2vq1 (more details), 2.5 Å

PDB Description: anti trimeric lewis x fab54-5c10-a
PDB Compounds: (E:) igkv1-117 protein

SCOPe Domain Sequences for d2vq1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vq1e2 b.1.1.2 (E:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d2vq1e2:

Click to download the PDB-style file with coordinates for d2vq1e2.
(The format of our PDB-style files is described here.)

Timeline for d2vq1e2: