SCOPe 2.08: Domain d2vq1e1: 2vq1 E:1-107

Lineage for d2vq1e1 (2vq1 E:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2vq1e1: 2vq1 E:1-107 [206415]
   Other proteins in same PDB: d2vq1a2, d2vq1b_, d2vq1e2, d2vq1f_
   automated match to d1t66c1
   complexed with azi, gly, gol

Details for d2vq1e1

PDB Entry: 2vq1, 2.5 Å

PDB Description: anti trimeric lewis x fab54-5c10-a

PDB Compounds: (E:) igkv1-117 protein

SCOPe Domain Sequences for d2vq1e1:

Sequence; same for both SEQRES and ATOM records:

>d2vq1e1 b.1.1.1 (E:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslsvslgdqasiscrssqslvhsngntflqwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrmeaedlgiyfcsqtthvpwtfgggtkleik

Timeline for d2vq1e1:

• d2vq1e1 first appeared in SCOPe 2.03
  
• d2vq1e1 appears in SCOPe 2.07