SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2vq1a1 (2vq1 A:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (20 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (144 PDB entries)
  8. 2020321Domain d2vq1a1: 2vq1 A:1-107 [206413]
    Other proteins in same PDB: d2vq1a2, d2vq1e2
    automated match to d1t66c1
    complexed with azi, gly, gol

Details for d2vq1a1

PDB Entry: 2vq1 (more details), 2.5 Å

PDB Description: anti trimeric lewis x fab54-5c10-a
PDB Compounds: (A:) igkv1-117 protein

SCOPe Domain Sequences for d2vq1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vq1a1 b.1.1.1 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslsvslgdqasiscrssqslvhsngntflqwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrmeaedlgiyfcsqtthvpwtfgggtkleik

SCOPe Domain Coordinates for d2vq1a1:

Click to download the PDB-style file with coordinates for d2vq1a1.
(The format of our PDB-style files is described here.)

Timeline for d2vq1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vq1a2