Lineage for d2vppb_ (2vpp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109418Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 2109419Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)
  8. 2109425Domain d2vppb_: 2vpp B: [206410]
    automated match to d1oe0a_
    complexed with geo, so4

Details for d2vppb_

PDB Entry: 2vpp (more details), 2.2 Å

PDB Description: drosophila melanogaster deoxyribonucleoside kinase successfully activates gemcitabine in transduced cancer cell lines
PDB Compounds: (B:) deoxynucleoside kinase

SCOPe Domain Sequences for d2vppb_:

Sequence, based on SEQRES records: (download)

>d2vppb_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmykdpkkwamp
fqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmyntleewykfi
eesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwlihqrrpqs
ckvlvld

Sequence, based on observed residues (ATOM records): (download)

>d2vppb_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmykdpkkwamp
fqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmyntleewykfi
eesihvqadliiylrtspevayerirqrseescvplkylqelhelhedwlihqrrpkvlv
ld

SCOPe Domain Coordinates for d2vppb_:

Click to download the PDB-style file with coordinates for d2vppb_.
(The format of our PDB-style files is described here.)

Timeline for d2vppb_: