Lineage for d1d9kb_ (1d9k B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 158716Protein T-cell antigen receptor [48933] (6 species)
  7. 158773Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (15 PDB entries)
  8. 158794Domain d1d9kb_: 1d9k B: [20641]
    Other proteins in same PDB: d1d9kc1, d1d9kc2, d1d9kd1, d1d9kd2, d1d9kg1, d1d9kg2, d1d9kh1, d1d9kh2

Details for d1d9kb_

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca

SCOP Domain Sequences for d1d9kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9kb_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgs

SCOP Domain Coordinates for d1d9kb_:

Click to download the PDB-style file with coordinates for d1d9kb_.
(The format of our PDB-style files is described here.)

Timeline for d1d9kb_: