Lineage for d1d9kb_ (1d9k B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein T-cell antigen receptor [48933] (5 species) Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries) 
Domain d1d9kb_: 1d9k B: [20641]
Other proteins in same PDB: d1d9kc1, d1d9kc2, d1d9kd1, d1d9kd2, d1d9kg1, d1d9kg2, d1d9kh1, d1d9kh2
Details for d1d9kb_
PDB Entry: 1d9k (more details), 3.2 Å
PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca
SCOP Domain Sequences for d1d9kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9kb_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgs
SCOP Domain Coordinates for d1d9kb_:
Click to download the PDB-style file with coordinates for d1d9kb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d9kb_:
- d1d9kb_ appears in SCOP 1.57
- d1d9kb_ appears in the current release, SCOPe 2.08
View in 3D
