Lineage for d2vppa_ (2vpp A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362080Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1362201Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 1362202Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (12 PDB entries)
  8. 1362207Domain d2vppa_: 2vpp A: [206409]
    automated match to d1oe0a_
    complexed with geo, so4

Details for d2vppa_

PDB Entry: 2vpp (more details), 2.2 Å

PDB Description: drosophila melanogaster deoxyribonucleoside kinase successfully activates gemcitabine in transduced cancer cell lines
PDB Compounds: (A:) deoxynucleoside kinase

SCOPe Domain Sequences for d2vppa_:

Sequence, based on SEQRES records: (download)

>d2vppa_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmykdpkkwa
mpfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmyntleewyk
fieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwlihqrrp
qsckvlvldadl

Sequence, based on observed residues (ATOM records): (download)

>d2vppa_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmykdpkkwa
mpfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmyntleewyk
fieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwlihqrrp
kvlvldadl

SCOPe Domain Coordinates for d2vppa_:

Click to download the PDB-style file with coordinates for d2vppa_.
(The format of our PDB-style files is described here.)

Timeline for d2vppa_: