SCOPe 2.08: Domain d2vp1b_: 2vp1 B:

Lineage for d2vp1b_ (2vp1 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1148] [225435] (2 PDB entries)

8. Domain d2vp1b_: 2vp1 B: [206408]
   automated match to d2pt1a_
   complexed with cl, fe, mes

Details for d2vp1b_

PDB Entry: 2vp1, 2.7 Å

PDB Description: fe-futa2 from synechocystis pcc6803

PDB Compounds: (B:) periplasmic iron-binding protein

SCOPe Domain Sequences for d2vp1b_:

Sequence; same for both SEQRES and ATOM records:

>d2vp1b_ c.94.1.0 (B:) automated matches {Synechocystis sp. [TaxId: 1148]}
rtinlyssrhyntddalydafgevnlieasaeelieriqseganspgdilftvdagmlwr
aeqaglfqpvrsgklneripenlrhpdglwygftqrarvlyysrdrvnpadlstyealad
pqwrgkilvrpssnvynlsltasriaihgepetrrwlqglvgnfarqpegndtaqiraia
agigdvaiansyyyirlqkstdpadqevvekvslffpntgsgergthvnvsgagvlknap
nrdaaiafleylasddaqryfaegnneypvipgvpidpvlaahgqlkgdplnvsnlgryq
pdsarlmnevgwq

Timeline for d2vp1b_:

• d2vp1b_ first appeared in SCOPe 2.03
  
• d2vp1b_ appears in SCOPe 2.07