Lineage for d2voga1 (2vog A:1-149)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2627094Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 2627095Protein automated matches [195066] (5 species)
    not a true protein
  7. 2627127Species Mouse (Mus musculus) [TaxId:10090] [195067] (5 PDB entries)
  8. 2627131Domain d2voga1: 2vog A:1-149 [206403]
    Other proteins in same PDB: d2voga2
    automated match to d2voia_
    complexed with cl

Details for d2voga1

PDB Entry: 2vog (more details), 1.9 Å

PDB Description: structure of mouse a1 bound to the bmf bh3-domain
PDB Compounds: (A:) bcl-2-related protein a1

SCOPe Domain Sequences for d2voga1:

Sequence, based on SEQRES records: (download)

>d2voga1 f.1.4.0 (A:1-149) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksylddfh
vesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvss
fvaefimnntgewirqnggwedgfikkfe

Sequence, based on observed residues (ATOM records): (download)

>d2voga1 f.1.4.0 (A:1-149) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maeselmhihslaehylqyvlqvpsqacrvlqrvafsvqkeveknlksylddfhvesidt
ariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvssfvaefi
mnntgewirqnggwedgfikkfe

SCOPe Domain Coordinates for d2voga1:

Click to download the PDB-style file with coordinates for d2voga1.
(The format of our PDB-style files is described here.)

Timeline for d2voga1: