SCOPe 2.06: Domain d2vo4b1: 2vo4 B:1-83

Lineage for d2vo4b1 (2vo4 B:1-83)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225579] (5 PDB entries)

8. Domain d2vo4b1: 2vo4 B:1-83 [206399]
   Other proteins in same PDB: d2vo4a2, d2vo4b2
   automated match to d1gwca2
   complexed with 4nm, gol, gtb

Details for d2vo4b1

PDB Entry: 2vo4, 1.75 Å

PDB Description: glutathione transferase from glycine max

PDB Compounds: (B:) 2,4-d inducible glutathione s-transferase

SCOPe Domain Sequences for d2vo4b1:

Sequence; same for both SEQRES and ATOM records:

>d2vo4b1 c.47.1.0 (B:1-83) automated matches {Soybean (Glycine max) [TaxId: 3847]}
mqdevvlldfwpspfgmrvrialaekgikyeykeedlrnksplllqmnpvhkkipvlihn
gkpicesliavqyieevwndrnp

Timeline for d2vo4b1:

• d2vo4b1 first appeared in SCOPe 2.03
  
• d2vo4b1 appears in SCOPe 2.05
  
• d2vo4b1 appears in SCOPe 2.07
  
• d2vo4b1 appears in the current release, SCOPe 2.08