Lineage for d2vo4a2 (2vo4 A:84-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714230Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries)
  8. 2714235Domain d2vo4a2: 2vo4 A:84-219 [206398]
    Other proteins in same PDB: d2vo4a1, d2vo4b1
    automated match to d1gwca1
    complexed with 4nm, gol, gtb

Details for d2vo4a2

PDB Entry: 2vo4 (more details), 1.75 Å

PDB Description: glutathione transferase from glycine max
PDB Compounds: (A:) 2,4-d inducible glutathione s-transferase

SCOPe Domain Sequences for d2vo4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vo4a2 a.45.1.0 (A:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]}
llpsdpyqraqtrfwadyvdkkiydlgrkiwtskgeekeaakkefiealklleeqlgdkt
yfggdnlgfvdialvpfytwfkayetfgtlniesecpkfiawakrclqkesvakslpdqq
kvyefimdlrkklgie

SCOPe Domain Coordinates for d2vo4a2:

Click to download the PDB-style file with coordinates for d2vo4a2.
(The format of our PDB-style files is described here.)

Timeline for d2vo4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vo4a1