SCOPe 2.08: Domain d2vnja1: 2vnj A:16-113

Lineage for d2vnja1 (2vnj A:16-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (22 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries)

8. Domain d2vnja1: 2vnj A:16-113 [206387]
   Other proteins in same PDB: d2vnja2
   automated match to d1a8pa1
   complexed with fad, htg, nap

Details for d2vnja1

PDB Entry: 2vnj, 2.13 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus in complex with nadp. form i at 2.13 angstroms resolution

PDB Compounds: (A:) nadph:ferredoxin reductase

SCOPe Domain Sequences for d2vnja1:

Sequence; same for both SEQRES and ATOM records:

>d2vnja1 b.43.4.0 (A:16-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspawde
elefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv

Timeline for d2vnja1:

• d2vnja1 first appeared in SCOPe 2.03
  
• d2vnja1 appears in SCOPe 2.07