Lineage for d2vnja1 (2vnj A:16-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793778Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries)
  8. 2793786Domain d2vnja1: 2vnj A:16-113 [206387]
    Other proteins in same PDB: d2vnja2
    automated match to d1a8pa1
    complexed with fad, htg, nap

Details for d2vnja1

PDB Entry: 2vnj (more details), 2.13 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus in complex with nadp. form i at 2.13 angstroms resolution
PDB Compounds: (A:) nadph:ferredoxin reductase

SCOPe Domain Sequences for d2vnja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnja1 b.43.4.0 (A:16-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspawde
elefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv

SCOPe Domain Coordinates for d2vnja1:

Click to download the PDB-style file with coordinates for d2vnja1.
(The format of our PDB-style files is described here.)

Timeline for d2vnja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vnja2