Lineage for d2vnha2 (2vnh A:114-272)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841107Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1841108Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1841268Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 1841269Protein automated matches [226871] (15 species)
    not a true protein
  7. 1841325Species Rhodobacter capsulatus [TaxId:1061] [225020] (7 PDB entries)
  8. 1841339Domain d2vnha2: 2vnh A:114-272 [206384]
    Other proteins in same PDB: d2vnha1
    automated match to d1a8pa2
    complexed with fad, htg, nap

Details for d2vnha2

PDB Entry: 2vnh (more details), 2.27 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus in complex with nadp. form ii at 2.27 angstroms resolution
PDB Compounds: (A:) nadph:ferredoxin reductase

SCOPe Domain Sequences for d2vnha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnha2 c.25.1.0 (A:114-272) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
idallpgkrlwflatgtgiapfaslmrepeayekfdevimmhacrtvaeleygrqlveal
qedpligelvegklkyyptttreefhhmgritdnlasgkvfedlgiapmnpetdramvcg
slafnvdvmkvlesyglreganseprefvvekafvgegi

SCOPe Domain Coordinates for d2vnha2:

Click to download the PDB-style file with coordinates for d2vnha2.
(The format of our PDB-style files is described here.)

Timeline for d2vnha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vnha1