Lineage for d2vn3a1 (2vn3 A:1-159)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding siteFamily b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) 
Protein automated matches [226877] (4 species)
not a true protein
Species Alcaligenes xylosoxydans [TaxId:85698] [225578] (6 PDB entries) 
Domain d2vn3a1: 2vn3 A:1-159 [206381]
automated match to d1gs7a1
complexed with cu, so4, zn
Details for d2vn3a1
PDB Entry: 2vn3 (more details), 2.35 Å
PDB Description: nitrite reductase from alcaligenes xylosoxidans
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductaseSCOPe Domain Sequences for d2vn3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vn3a1 b.6.1.3 (A:1-159) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp
SCOPe Domain Coordinates for d2vn3a1:
Click to download the PDB-style file with coordinates for d2vn3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vn3a1:
- d2vn3a1 first appeared in SCOPe 2.03
- d2vn3a1 appears in SCOPe 2.07
View in 3D
