SCOPe 2.08: Domain d2vmja2: 2vmj A:152-327

Lineage for d2vmja2 (2vmj A:152-327)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein automated matches [226877] (4 species)
   not a true protein

7. Species Alcaligenes xylosoxydans [TaxId:85698] [225578] (6 PDB entries)

8. Domain d2vmja2: 2vmj A:152-327 [206380]
   automated match to d1oe1a2
   complexed with epe, zn; mutant

Details for d2vmja2

PDB Entry: 2vmj, 2.5 Å

PDB Description: type 1 copper-binding loop of nitrite reductase mutant: 130-capegmvpwhvvsgm-144 to 130-ctphpfm-136

PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2vmja2:

Sequence; same for both SEQRES and ATOM records:

>d2vmja2 b.6.1.3 (A:152-327) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip

Timeline for d2vmja2:

• d2vmja2 first appeared in SCOPe 2.03
  
• d2vmja2 appears in SCOPe 2.07