Lineage for d2ckbd1 (2ckb D:1-117)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288452Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 288516Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (16 PDB entries)
  8. 288537Domain d2ckbd1: 2ckb D:1-117 [20638]
    Other proteins in same PDB: d2ckba2, d2ckbb2, d2ckbc2, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl_, d2ckbm_

Details for d2ckbd1

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

SCOP Domain Coordinates for d2ckbd1:

Click to download the PDB-style file with coordinates for d2ckbd1.
(The format of our PDB-style files is described here.)

Timeline for d2ckbd1: