![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
![]() | Family g.52.1.0: automated matches [227222] (1 protein) not a true family |
![]() | Protein automated matches [226963] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225401] (1 PDB entry) |
![]() | Domain d2vm5a_: 2vm5 A: [206378] automated match to d1oxne_ complexed with gol, zn |
PDB Entry: 2vm5 (more details), 1.8 Å
SCOPe Domain Sequences for d2vm5a_:
Sequence, based on SEQRES records: (download)
>d2vm5a_ g.52.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smrvknlksrlrggkmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcf scggclgnweegddpwkehakwfpkceflrskksseeitqyiqsyk
>d2vm5a_ g.52.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smrvknlksrlrmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcfscg gclgnweegddpwkehakwfpkceflrskksseeitqyiqsyk
Timeline for d2vm5a_: