Lineage for d2vm5a_ (2vm5 A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707316Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1707317Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 1707518Family g.52.1.0: automated matches [227222] (1 protein)
    not a true family
  6. 1707519Protein automated matches [226963] (1 species)
    not a true protein
  7. 1707520Species Human (Homo sapiens) [TaxId:9606] [225401] (1 PDB entry)
  8. 1707521Domain d2vm5a_: 2vm5 A: [206378]
    automated match to d1oxne_
    complexed with gol, zn

Details for d2vm5a_

PDB Entry: 2vm5 (more details), 1.8 Å

PDB Description: human bir2 domain of baculoviral inhibitor of apoptosis repeat- containing 1 (birc1)
PDB Compounds: (A:) baculoviral iap repeat-containing protein 1

SCOPe Domain Sequences for d2vm5a_:

Sequence, based on SEQRES records: (download)

>d2vm5a_ g.52.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrvknlksrlrggkmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcf
scggclgnweegddpwkehakwfpkceflrskksseeitqyiqsyk

Sequence, based on observed residues (ATOM records): (download)

>d2vm5a_ g.52.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrvknlksrlrmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcfscg
gclgnweegddpwkehakwfpkceflrskksseeitqyiqsyk

SCOPe Domain Coordinates for d2vm5a_:

Click to download the PDB-style file with coordinates for d2vm5a_.
(The format of our PDB-style files is described here.)

Timeline for d2vm5a_: