SCOPe 2.03: Domain d2vm5a_: 2vm5 A:

Lineage for d2vm5a_ (2vm5 A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.0: automated matches [227222] (1 protein)
   not a true family

6. Protein automated matches [226963] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225401] (1 PDB entry)

8. Domain d2vm5a_: 2vm5 A: [206378]
   automated match to d1oxne_
   complexed with gol, zn

Details for d2vm5a_

PDB Entry: 2vm5, 1.8 Å

PDB Description: human bir2 domain of baculoviral inhibitor of apoptosis repeat- containing 1 (birc1)

PDB Compounds: (A:) baculoviral iap repeat-containing protein 1

SCOPe Domain Sequences for d2vm5a_:

Sequence, based on SEQRES records:

>d2vm5a_ g.52.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrvknlksrlrggkmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcf
scggclgnweegddpwkehakwfpkceflrskksseeitqyiqsyk

Sequence, based on observed residues (ATOM records):

>d2vm5a_ g.52.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrvknlksrlrmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcfscg
gclgnweegddpwkehakwfpkceflrskksseeitqyiqsyk

Timeline for d2vm5a_:

• d2vm5a_ is new in SCOPe 2.03-stable
  
• d2vm5a_ appears in SCOPe 2.04
  
• d2vm5a_ appears in the current release, SCOPe 2.08, called d2vm5a1