Lineage for d2vm5a1 (2vm5 A:141-244)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038288Family g.52.1.0: automated matches [227222] (1 protein)
    not a true family
  6. 3038289Protein automated matches [226963] (1 species)
    not a true protein
  7. 3038290Species Human (Homo sapiens) [TaxId:9606] [225401] (1 PDB entry)
  8. 3038291Domain d2vm5a1: 2vm5 A:141-244 [206378]
    Other proteins in same PDB: d2vm5a2
    automated match to d1oxne_
    complexed with gol, zn

Details for d2vm5a1

PDB Entry: 2vm5 (more details), 1.8 Å

PDB Description: human bir2 domain of baculoviral inhibitor of apoptosis repeat- containing 1 (birc1)
PDB Compounds: (A:) baculoviral iap repeat-containing protein 1

SCOPe Domain Sequences for d2vm5a1:

Sequence, based on SEQRES records: (download)

>d2vm5a1 g.52.1.0 (A:141-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvknlksrlrggkmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcfsc
ggclgnweegddpwkehakwfpkceflrskksseeitqyiqsyk

Sequence, based on observed residues (ATOM records): (download)

>d2vm5a1 g.52.1.0 (A:141-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvknlksrlrmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcfscggc
lgnweegddpwkehakwfpkceflrskksseeitqyiqsyk

SCOPe Domain Coordinates for d2vm5a1:

Click to download the PDB-style file with coordinates for d2vm5a1.
(The format of our PDB-style files is described here.)

Timeline for d2vm5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vm5a2