Lineage for d2vigg1 (2vig G:34-258)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015485Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 3015575Protein automated matches [226961] (2 species)
    not a true protein
  7. 3015605Species Human (Homo sapiens) [TaxId:9606] [225392] (3 PDB entries)
  8. 3015612Domain d2vigg1: 2vig G:34-258 [206374]
    Other proteins in same PDB: d2viga2, d2vigb2, d2vigc2, d2vigc3, d2vigd2, d2vigd3, d2vige2, d2vige3, d2vigf2, d2vigf3, d2vigg2, d2vigh2, d2vigh3
    automated match to d1jqia2
    complexed with cos, edo, fad

Details for d2vigg1

PDB Entry: 2vig (more details), 1.9 Å

PDB Description: crystal structure of human short-chain acyl coa dehydrogenase
PDB Compounds: (G:) short-chain specific acyl-coa dehydrogenase,

SCOPe Domain Sequences for d2vigg1:

Sequence, based on SEQRES records: (download)

>d2vigg1 e.6.1.1 (G:34-258) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnksisaf
lvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepg

Sequence, based on observed residues (ATOM records): (download)

>d2vigg1 e.6.1.1 (G:34-258) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdqnksisaflvp
mptpgltlgkkedklgirgsstanlifedcripkdsilgepg

SCOPe Domain Coordinates for d2vigg1:

Click to download the PDB-style file with coordinates for d2vigg1.
(The format of our PDB-style files is described here.)

Timeline for d2vigg1: