Lineage for d2vige1 (2vig E:34-258)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1950935Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1950936Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1950937Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 1951027Protein automated matches [226961] (2 species)
    not a true protein
  7. 1951057Species Human (Homo sapiens) [TaxId:9606] [225392] (3 PDB entries)
  8. 1951062Domain d2vige1: 2vig E:34-258 [206370]
    Other proteins in same PDB: d2viga2, d2vigb2, d2vigc2, d2vigd2, d2vige2, d2vigf2, d2vigg2, d2vigh2
    automated match to d1jqia2
    complexed with cos, edo, fad

Details for d2vige1

PDB Entry: 2vig (more details), 1.9 Å

PDB Description: crystal structure of human short-chain acyl coa dehydrogenase
PDB Compounds: (E:) short-chain specific acyl-coa dehydrogenase,

SCOPe Domain Sequences for d2vige1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vige1 e.6.1.1 (E:34-258) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnksisaf
lvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepg

SCOPe Domain Coordinates for d2vige1:

Click to download the PDB-style file with coordinates for d2vige1.
(The format of our PDB-style files is described here.)

Timeline for d2vige1: