SCOPe 2.03: Domain d2vige1: 2vig E:34-258

Lineage for d2vige1 (2vig E:34-258)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)

6. Protein automated matches [226961] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225392] (1 PDB entry)

8. Domain d2vige1: 2vig E:34-258 [206370]
   Other proteins in same PDB: d2viga2, d2vigb2, d2vigc2, d2vigd2, d2vige2, d2vigf2, d2vigg2, d2vigh2
   automated match to d1jqia2
   complexed with cos, edo, fad

Details for d2vige1

PDB Entry: 2vig, 1.9 Å

PDB Description: crystal structure of human short-chain acyl coa dehydrogenase

PDB Compounds: (E:) short-chain specific acyl-coa dehydrogenase,

SCOPe Domain Sequences for d2vige1:

Sequence; same for both SEQRES and ATOM records:

>d2vige1 e.6.1.1 (E:34-258) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnksisaf
lvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepg

Timeline for d2vige1:

• d2vige1 is new in SCOPe 2.03-stable
  
• d2vige1 appears in SCOPe 2.04
  
• d2vige1 appears in the current release, SCOPe 2.08